channel

Necessarius47

Send message
More
Report user
  • Home
  • Videos
  • Posts
  • Fighters
  • Bundles -20%
  • About
Tag
absactorarmpitasmrbellyachebellybuttonbellymovementbellyrollbellyrubsbloatingbreathingburpingchesttramplingchloroformcollegecprcustomrequestdadboddaddydilfeatingedgingelectroelectromuscleelectrostimemetoemetophiliaemsenemaextractorflexinggutpunchguttramplinghandjobinflationinnietooutieknucklesmalepossessionmanagermassagemawmedicalmindmouthmouthplaympregmusclegutmuscleworshipnavelnavellickingnavelpenetrationnavelplaynipplespecplaypecspiggybackingpinoypreviewprivaterescuebreathssalivaplayshowerscenesilentvideosoftpunchstomachnoisestomachpainstomachvacuumstuffingswallowingsyringeticklingtramplingvacuumvomitvore
Popularity Most viewed Date added (oldest) Date added (newest)
79 videos
post 16:58FullHDFullHD
Manager's Incentive for a Productive Staff (Gut Punch Session)
$10.49 17 views 4 day
post 20:48FullHDFullHD
A Navel as a Pin Cushion? Manager Reporting for Duty!
$11.49 26 views 1 wk
post 5:524K4K
Lance Showcases his Durability and Strength
716 views 1 wk
post 12:44FullHDFullHD
The Solution for Pierce's Erectile Dysfunction
$6.49 8 views 2 wk
post 10:09FullHDFullHD
Simulating a Preggo Belly ft. Chef
$4.99 1 views 2 wk
post 10:01FullHDFullHD
Pierce's Body Invaded ft. Dick ﹠ Mouth
$5.49 4 views 3 wk
post 15:54FullHDFullHD
Pierce's Tummy VS Chinese Food ﹠ 1L of Milk
$7.99 4 views 4 wk
post 16:18FullHDFullHD
Nipples, Needles and a Raging Dick (Part 2)
$9.99 0 views 5 wk
post 11:46FullHDFullHD
Nipples, Needles and a Raging Dick (Part 1)
$7.99 4 views 6 wk
post 5:01FullHDFullHD
Pierce's Navel gets Compromised by an Entity
735 views 7 wk
post 7:52FullHDFullHD
Irresistible Nipples ft. Pierce
964 views 7 wk
post 15:32FullHDFullHD
Getting a Taste of CPR Medicine ft. Pierce
$10.49 47 views 8 wk
post 17:49FullHDFullHD
Punching ﹠ Trampling Pierce's Hard-earned Abs
$10.99 6 views 9 wk
post 11:56FullHDFullHD
Manager Needs his Daily Protein Intake ft. Gummy Bears
$7.49 9 views 10 wk
post 17:44FullHDFullHD
Fingering Nipples ﹠ Navels ft. Manager
$10.49 6 views 11 wk
post 16:09FullHDFullHD
Undertaking Manager into an Obedient Pet
$7.99 0 views 12 wk
post 11:33FullHDFullHD
Body Autonomy Snatched!! Ft. Manager
$5.49 21 views 13 wk
post 24:46FullHDFullHD
Mind Conditioning Manager's Psyche ft. Edging
$15.99 39 views 14 wk
post 16:50FullHDFullHD
Resist or Give in? Manager's Abs gets Disciplined
$9.99 58 views 15 wk
post 27:59FullHDFullHD
Final Interview: Bodyguard's Navel Inspection
$14.49 10 views 16 wk
post 11:46FullHDFullHD
Selection of Tools to Unlock Bodyguard's Navel
$5.99 3 views 17 wk
post 19:57FullHDFullHD
Manager gets Resuscitated Twice
$12.99 86 views 17 wk
post 13:59FullHDFullHD
Bodyguard undergoes a Screening Exam
$6.99 26 views 18 wk
post 16:50FullHDFullHD
A Tired Manager gets a Visitor
$9.99 26 views 19 wk
post 10:31FullHDFullHD
Sensory Overload ft. Manager's Torso
$4.99 11 views 19 wk
post 17:16FullHDFullHD
Body Enhancement: ROA via Navel ft. Bodyguard
$12.49 7 views 20 wk
post 10:34FullHDFullHD
¡SILENT! Bodyguard applies for a Bouncer Position
1325 views 21 wk
post 3:26FullHDFullHD
Thirsty AF! Manager chugs Water like a BOSS
1531 views 21 wk
post 21:54FullHDFullHD
Voracious Appetite from a Hungry Manager
$12.99 32 views 22 wk
post 13:134K4K
An Arrogant Manager taunts his Employee
$7.99 122 views 23 wk
79 videos